Anti-GSDMA
Artikelnummer:
ATA-HPA064826
- Bilder (9)
| Artikelname: | Anti-GSDMA |
| Artikelnummer: | ATA-HPA064826 |
| Hersteller Artikelnummer: | HPA064826 |
| Alternativnummer: | ATA-HPA064826-100,ATA-HPA064826-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ39120, GSDM, GSDM1 |
| gasdermin A |
| Anti-GSDMA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 284110 |
| UniProt: | Q96QA5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GSDMA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skin and pancreas tissues using Anti-GSDMA antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody HPA064826 (A) shows similar protein distribution across tissues to independent antibody HPA023313 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-GSDMA antibody HPA064826. |
|
|
Immunohistochemical staining of human lymph node using Anti-GSDMA antibody HPA064826. |
|
|
HPA064826-100ul |
|
|
HPA064826-100ul |
|
|
HPA064826-100ul |
Produktgarantie und fachkundiger Support
