Anti-GSDMA
Catalog Number:
ATA-HPA064826
- Images (9)
| Article Name: | Anti-GSDMA |
| Biozol Catalog Number: | ATA-HPA064826 |
| Supplier Catalog Number: | HPA064826 |
| Alternative Catalog Number: | ATA-HPA064826-100,ATA-HPA064826-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ39120, GSDM, GSDM1 |
| gasdermin A |
| Anti-GSDMA |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 284110 |
| UniProt: | Q96QA5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GSDMA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skin and pancreas tissues using Anti-GSDMA antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody HPA064826 (A) shows similar protein distribution across tissues to independent antibody HPA023313 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-GSDMA antibody HPA064826. |
|
|
Immunohistochemical staining of human lymph node using Anti-GSDMA antibody HPA064826. |
|
|
HPA064826-100ul |
|
|
HPA064826-100ul |
|
|
HPA064826-100ul |
Product Guarantee and Expert Support
