Anti-SPICE1

Artikelnummer: ATA-HPA064843
Artikelname: Anti-SPICE1
Artikelnummer: ATA-HPA064843
Hersteller Artikelnummer: HPA064843
Alternativnummer: ATA-HPA064843-100,ATA-HPA064843-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CCDC52, SPICE
spindle and centriole associated protein 1
Anti-SPICE1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 152185
UniProt: Q8N0Z3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPICE1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SPICE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408168).
HPA064843-100ul
HPA064843-100ul
HPA064843-100ul