Anti-SPICE1
Catalog Number:
ATA-HPA064843
- Images (8)
| Article Name: | Anti-SPICE1 |
| Biozol Catalog Number: | ATA-HPA064843 |
| Supplier Catalog Number: | HPA064843 |
| Alternative Catalog Number: | ATA-HPA064843-100,ATA-HPA064843-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CCDC52, SPICE |
| spindle and centriole associated protein 1 |
| Anti-SPICE1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 152185 |
| UniProt: | Q8N0Z3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPICE1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to centrosome. |
|
|
Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts and Leydig cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SPICE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408168). |
|
|
HPA064843-100ul |
|
|
|
|
|
|
|
|
HPA064843-100ul |
|
|
HPA064843-100ul |
Product Guarantee and Expert Support
