Anti-SFRP1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA064870
Artikelname: Anti-SFRP1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA064870
Hersteller Artikelnummer: HPA064870
Alternativnummer: ATA-HPA064870-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FRP, FRP-1, SARP2
secreted frizzled-related protein 1
Anti-SFRP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 6422
UniProt: Q8N474
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoli.
Western blot analysis in human cell line RT-4.