Anti-SFRP1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SFRP1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA064870
• Supplier Catalog Number: HPA064870
• Alternative Catalog Number: ATA-HPA064870-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB, ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FRP, FRP-1, SARP2

Product Description

secreted frizzled-related protein 1

Additional Information

Anti-SFRP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 6422
• UniProt: Q8N474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoli.

Western blot analysis in human cell line RT-4.