Anti-JAKMIP2

Artikelnummer: ATA-HPA065023
Artikelname: Anti-JAKMIP2
Artikelnummer: ATA-HPA065023
Hersteller Artikelnummer: HPA065023
Alternativnummer: ATA-HPA065023-100,ATA-HPA065023-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JAMIP2, KIAA0555
janus kinase and microtubule interacting protein 2
Anti-JAKMIP2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9832
UniProt: Q96AA8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: JAKMIP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line RH-30 shows localization to the Golgi apparatus.
HPA065023-100ul