Anti-JAKMIP2
Catalog Number:
ATA-HPA065023
| Article Name: |
Anti-JAKMIP2 |
| Biozol Catalog Number: |
ATA-HPA065023 |
| Supplier Catalog Number: |
HPA065023 |
| Alternative Catalog Number: |
ATA-HPA065023-100,ATA-HPA065023-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
JAMIP2, KIAA0555 |
| janus kinase and microtubule interacting protein 2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 mg/ml |
| Isotype: |
IgG |
| NCBI: |
9832 |
| UniProt: |
Q96AA8 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
JAKMIP2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line RH-30 shows localization to the Golgi apparatus. |
![]()
|
HPA065023-100ul |
