Anti-CLASP1

Artikelnummer: ATA-HPA065219
Artikelname: Anti-CLASP1
Artikelnummer: ATA-HPA065219
Hersteller Artikelnummer: HPA065219
Alternativnummer: ATA-HPA065219-100,ATA-HPA065219-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0622, MAST1
cytoplasmic linker associated protein 1
Anti-CLASP1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 23332
UniProt: Q7Z460
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLASP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
HPA065219-100ul