Anti-CLASP1

Catalog Number: ATA-HPA065219
Article Name: Anti-CLASP1
Biozol Catalog Number: ATA-HPA065219
Supplier Catalog Number: HPA065219
Alternative Catalog Number: ATA-HPA065219-100,ATA-HPA065219-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0622, MAST1
cytoplasmic linker associated protein 1
Anti-CLASP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23332
UniProt: Q7Z460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLASP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
HPA065219-100ul