Anti-ATOH1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA065568
Artikelname: Anti-ATOH1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA065568
Hersteller Artikelnummer: HPA065568
Alternativnummer: ATA-HPA065568-100,ATA-HPA065568-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHa14, HATH1, MATH-1, Math1
Klonalität: Polyclonal
Konzentration: 0,4
NCBI: 474
UniProt: Q92858
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGV
Target-Kategorie: ATOH1
HPA065568