Anti-ATOH1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA065568
Article Name: Anti-ATOH1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA065568
Supplier Catalog Number: HPA065568
Alternative Catalog Number: ATA-HPA065568-100,ATA-HPA065568-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHa14, HATH1, MATH-1, Math1
Clonality: Polyclonal
Concentration: 0,4
NCBI: 474
UniProt: Q92858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGV
Target: ATOH1
HPA065568