Anti-SLC40A1
Artikelnummer:
ATA-HPA065634
- Bilder (9)
| Artikelname: | Anti-SLC40A1 |
| Artikelnummer: | ATA-HPA065634 |
| Hersteller Artikelnummer: | HPA065634 |
| Alternativnummer: | ATA-HPA065634-100,ATA-HPA065634-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FPN1, HFE4, IREG1, MTP1, SLC11A3 |
| solute carrier family 40 (iron-regulated transporter), member 1 |
| Anti-SLC40A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 30061 |
| UniProt: | Q9NP59 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC40A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human spleen shows weak to moderate cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate positivity in erythrocytes. |
|
|
Immunohistochemical staining of human duodenum shows weak cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected. |
|
|
HPA065634-100ul |
|
|
|
|
|
HPA065634-100ul |
|
|
HPA065634-100ul |
Produktgarantie und fachkundiger Support
