Anti-SLC40A1
Catalog Number:
ATA-HPA065634
- Images (9)
| Article Name: | Anti-SLC40A1 |
| Biozol Catalog Number: | ATA-HPA065634 |
| Supplier Catalog Number: | HPA065634 |
| Alternative Catalog Number: | ATA-HPA065634-100,ATA-HPA065634-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FPN1, HFE4, IREG1, MTP1, SLC11A3 |
| solute carrier family 40 (iron-regulated transporter), member 1 |
| Anti-SLC40A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 30061 |
| UniProt: | Q9NP59 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC40A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human spleen shows weak to moderate cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate positivity in erythrocytes. |
|
|
Immunohistochemical staining of human duodenum shows weak cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected. |
|
|
HPA065634-100ul |
|
|
|
|
|
HPA065634-100ul |
|
|
HPA065634-100ul |
Product Guarantee and Expert Support
