Anti-CD5L

Artikelnummer: ATA-HPA065686
Artikelname: Anti-CD5L
Artikelnummer: ATA-HPA065686
Hersteller Artikelnummer: HPA065686
Alternativnummer: ATA-HPA065686-100,ATA-HPA065686-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: API6, Spalpha
CD5 molecule-like
Anti-CD5L
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 922
UniProt: O43866
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD5L
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using HPA065686 antibody. Corresponding CD5L RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and spleen using Anti-CD5L antibody HPA065686 (A) shows similar protein distribution across tissues to independent antibody HPA068384 (B).
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma in blood vessels.
HPA065686-100ul
HPA065686-100ul
HPA065686-100ul