Anti-CD5L

Product Overview

• Article Name: Anti-CD5L
• Biozol Catalog Number: ATA-HPA065686
• Supplier Catalog Number: HPA065686
• Alternative Catalog Number: ATA-HPA065686-100,ATA-HPA065686-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: API6, Spalpha

Product Description

CD5 molecule-like

Additional Information

Anti-CD5L

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 922
• UniProt: O43866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CD5L
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000

Images

Immunohistochemistry analysis in human spleen and cerebral cortex tissues using HPA065686 antibody. Corresponding CD5L RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and spleen using Anti-CD5L antibody HPA065686 (A) shows similar protein distribution across tissues to independent antibody HPA068384 (B).

Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma in blood vessels.

HPA065686-100ul

HPA065686-100ul

HPA065686-100ul