Anti-ADPRHL1

Artikelnummer: ATA-HPA066478
Artikelname: Anti-ADPRHL1
Artikelnummer: ATA-HPA066478
Hersteller Artikelnummer: HPA066478
Alternativnummer: ATA-HPA066478-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARH2
ADP-ribosylhydrolase like 1

Anti-ADPRHL1

Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 113622
UniProt: Q8NDY3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADPRHL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-ADPRHL1 antibody. Corresponding ADPRHL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Skeletal muscle tissue
HPA066478-100ul
HPA066478-100ul
HPA066478-100ul