Anti-ADPRHL1
Catalog Number:
ATA-HPA066478
- Images (10)
| Article Name: | Anti-ADPRHL1 |
| Biozol Catalog Number: | ATA-HPA066478 |
| Supplier Catalog Number: | HPA066478 |
| Alternative Catalog Number: | ATA-HPA066478-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARH2 |
| ADP-ribosylhydrolase like 1 |
| Anti-ADPRHL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 113622 |
| UniProt: | Q8NDY3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADPRHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-ADPRHL1 antibody. Corresponding ADPRHL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Skeletal muscle tissue |
|
|
|
|
|
HPA066478-100ul |
|
|
|
|
|
HPA066478-100ul |
|
|
HPA066478-100ul |
Product Guarantee and Expert Support
