Anti-RIMS2
Artikelnummer:
ATA-HPA066498
- Bilder (7)
| Artikelname: | Anti-RIMS2 |
| Artikelnummer: | ATA-HPA066498 |
| Hersteller Artikelnummer: | HPA066498 |
| Alternativnummer: | ATA-HPA066498-100,ATA-HPA066498-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0751, OBOE, RAB3IP3, RIM2 |
| regulating synaptic membrane exocytosis 2 |
| Anti-RIMS2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9699 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RIMS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-RIMS2 antibody. Corresponding RIMS2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human adrenal gland shows strong granulated cytoplasmic positivity in cortical cells. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA066498-100ul |
|
|
HPA066498-100ul |
|
|
HPA066498-100ul |
Produktgarantie und fachkundiger Support
