Anti-RIMS2
Catalog Number:
ATA-HPA066498
- Images (7)
| Article Name: | Anti-RIMS2 |
| Biozol Catalog Number: | ATA-HPA066498 |
| Supplier Catalog Number: | HPA066498 |
| Alternative Catalog Number: | ATA-HPA066498-100,ATA-HPA066498-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0751, OBOE, RAB3IP3, RIM2 |
| regulating synaptic membrane exocytosis 2 |
| Anti-RIMS2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9699 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RIMS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-RIMS2 antibody. Corresponding RIMS2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human adrenal gland shows strong granulated cytoplasmic positivity in cortical cells. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA066498-100ul |
|
|
HPA066498-100ul |
|
|
HPA066498-100ul |
Product Guarantee and Expert Support
