Anti-CMIP
Artikelnummer:
ATA-HPA066710
- Bilder (7)
| Artikelname: | Anti-CMIP |
| Artikelnummer: | ATA-HPA066710 |
| Hersteller Artikelnummer: | HPA066710 |
| Alternativnummer: | ATA-HPA066710-100,ATA-HPA066710-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CMIP |
| c-Maf inducing protein |
| Anti-CMIP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80790 |
| UniProt: | Q8IY22 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CMIP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CMIP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell lines A-549 and SK-MEL-30 using Anti-CMIP antibody. Corresponding CMIP RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
|
|
|
HPA066710-100ul |
|
|
HPA066710-100ul |
|
|
HPA066710-100ul |
Produktgarantie und fachkundiger Support
