Anti-CMIP
Catalog Number:
ATA-HPA066710
- Images (7)
| Article Name: | Anti-CMIP |
| Biozol Catalog Number: | ATA-HPA066710 |
| Supplier Catalog Number: | HPA066710 |
| Alternative Catalog Number: | ATA-HPA066710-100,ATA-HPA066710-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMIP |
| c-Maf inducing protein |
| Anti-CMIP |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 80790 |
| UniProt: | Q8IY22 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CMIP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CMIP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell lines A-549 and SK-MEL-30 using Anti-CMIP antibody. Corresponding CMIP RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
|
|
|
HPA066710-100ul |
|
|
HPA066710-100ul |
|
|
HPA066710-100ul |
Product Guarantee and Expert Support
