Anti-FOXA2
Artikelnummer:
ATA-HPA066846
- Bilder (3)
| Artikelname: | Anti-FOXA2 |
| Artikelnummer: | ATA-HPA066846 |
| Hersteller Artikelnummer: | HPA066846 |
| Alternativnummer: | ATA-HPA066846-100,ATA-HPA066846-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HNF3B |
| forkhead box A2 |
| Anti-FOXA2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3170 |
| UniProt: | Q9Y261 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FOXA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cell junctions. |
|
|
HPA066846-100ul |
|
|
HPA066846-100ul |
Produktgarantie und fachkundiger Support
