Anti-FOXA2
Catalog Number:
ATA-HPA066846
- Images (3)
| Article Name: | Anti-FOXA2 |
| Biozol Catalog Number: | ATA-HPA066846 |
| Supplier Catalog Number: | HPA066846 |
| Alternative Catalog Number: | ATA-HPA066846-100,ATA-HPA066846-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HNF3B |
| forkhead box A2 |
| Anti-FOXA2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3170 |
| UniProt: | Q9Y261 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOXA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cell junctions. |
|
|
HPA066846-100ul |
|
|
HPA066846-100ul |
Product Guarantee and Expert Support
