Anti-FOXJ3 ChIP certified

Artikelnummer: ATA-HPA067284
Artikelname: Anti-FOXJ3 ChIP certified
Artikelnummer: ATA-HPA067284
Hersteller Artikelnummer: HPA067284
Alternativnummer: ATA-HPA067284-100,ATA-HPA067284-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1041
forkhead box J3
Anti-FOXJ3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 22887
UniProt: Q9UPW0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOXJ3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles.
HPA067284-100ul