Anti-FOXJ3 ChIP certified

Catalog Number: ATA-HPA067284
Article Name: Anti-FOXJ3 ChIP certified
Biozol Catalog Number: ATA-HPA067284
Supplier Catalog Number: HPA067284
Alternative Catalog Number: ATA-HPA067284-100,ATA-HPA067284-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1041
forkhead box J3
Anti-FOXJ3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 22887
UniProt: Q9UPW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FOXJ3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles.
HPA067284-100ul