Anti-ENG
Artikelnummer:
ATA-HPA067440
- Bilder (8)
| Artikelname: | Anti-ENG |
| Artikelnummer: | ATA-HPA067440 |
| Hersteller Artikelnummer: | HPA067440 |
| Alternativnummer: | ATA-HPA067440-100,ATA-HPA067440-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD105, END, HHT1, ORW, ORW1 |
| endoglin |
| Anti-ENG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2022 |
| UniProt: | P17813 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ENG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA067440 antibody. Corresponding ENG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human testis shows moderate membranous positivity in peritubular myoid cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
HPA067440-100ul |
|
|
HPA067440-100ul |
|
|
HPA067440-100ul |
Produktgarantie und fachkundiger Support
