Anti-ENG
Catalog Number:
ATA-HPA067440
- Images (8)
| Article Name: | Anti-ENG |
| Biozol Catalog Number: | ATA-HPA067440 |
| Supplier Catalog Number: | HPA067440 |
| Alternative Catalog Number: | ATA-HPA067440-100,ATA-HPA067440-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD105, END, HHT1, ORW, ORW1 |
| endoglin |
| Anti-ENG |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 2022 |
| UniProt: | P17813 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ENG |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA067440 antibody. Corresponding ENG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human testis shows moderate membranous positivity in peritubular myoid cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
HPA067440-100ul |
|
|
HPA067440-100ul |
|
|
HPA067440-100ul |
Product Guarantee and Expert Support
