Anti-MLC1

Artikelnummer: ATA-HPA067533
Artikelname: Anti-MLC1
Artikelnummer: ATA-HPA067533
Hersteller Artikelnummer: HPA067533
Alternativnummer: ATA-HPA067533-100,ATA-HPA067533-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0027, LVM, MLC, VL
megalencephalic leukoencephalopathy with subcortical cysts 1
Anti-MLC1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23209
UniProt: Q15049
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MLC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408351).
HPA067533-100ul
HPA067533-100ul
HPA067533-100ul