Anti-MLC1

Catalog Number: ATA-HPA067533
Article Name: Anti-MLC1
Biozol Catalog Number: ATA-HPA067533
Supplier Catalog Number: HPA067533
Alternative Catalog Number: ATA-HPA067533-100,ATA-HPA067533-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0027, LVM, MLC, VL
megalencephalic leukoencephalopathy with subcortical cysts 1
Anti-MLC1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23209
UniProt: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MLC1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408351).
HPA067533-100ul
HPA067533-100ul
HPA067533-100ul