Anti-WSB1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA067752
| Artikelname: |
Anti-WSB1, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA067752 |
| Hersteller Artikelnummer: |
HPA067752 |
| Alternativnummer: |
ATA-HPA067752-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
DKFZp564A122, DKFZp564B0482, SWIP1 |
| Rabbit Polyclonal WSB1 Antibody against Human WD repeat and SOCS box containing 1. Validated for Western Blot |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 |
| NCBI: |
26118 |
| UniProt: |
Q9Y6I7 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequenz: |
SYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVA |