Anti-WSB1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-WSB1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA067752
• Supplier Catalog Number: HPA067752
• Alternative Catalog Number: ATA-HPA067752-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: DKFZp564A122, DKFZp564B0482, SWIP1

Product Description

Rabbit Polyclonal WSB1 Antibody against Human WD repeat and SOCS box containing 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 26118
• UniProt: Q9Y6I7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: SYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVA