Anti-CTR9
Artikelnummer:
ATA-HPA068122
- Bilder (10)
| Artikelname: | Anti-CTR9 |
| Artikelnummer: | ATA-HPA068122 |
| Hersteller Artikelnummer: | HPA068122 |
| Alternativnummer: | ATA-HPA068122-100,ATA-HPA068122-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0155, p150TSP, SH2BP1, TSBP |
| CTR9, Paf1/RNA polymerase II complex component |
| Anti-CTR9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9646 |
| UniProt: | Q6PD62 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CTR9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human urinary bladder and pancreas tissues using Anti-CTR9 antibody. Corresponding CTR9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human urinary bladder shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA068122-100ul |
|
|
|
|
|
|
|
|
HPA068122-100ul |
|
|
HPA068122-100ul |
Produktgarantie und fachkundiger Support
