Anti-CTR9
Catalog Number:
ATA-HPA068122
- Images (10)
| Article Name: | Anti-CTR9 |
| Biozol Catalog Number: | ATA-HPA068122 |
| Supplier Catalog Number: | HPA068122 |
| Alternative Catalog Number: | ATA-HPA068122-100,ATA-HPA068122-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0155, p150TSP, SH2BP1, TSBP |
| CTR9, Paf1/RNA polymerase II complex component |
| Anti-CTR9 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9646 |
| UniProt: | Q6PD62 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CTR9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human urinary bladder and pancreas tissues using Anti-CTR9 antibody. Corresponding CTR9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human urinary bladder shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA068122-100ul |
|
|
|
|
|
|
|
|
HPA068122-100ul |
|
|
HPA068122-100ul |
Product Guarantee and Expert Support
