Anti-DDIT3
Artikelnummer:
ATA-HPA068416
- Bilder (7)
| Artikelname: | Anti-DDIT3 |
| Artikelnummer: | ATA-HPA068416 |
| Hersteller Artikelnummer: | HPA068416 |
| Alternativnummer: | ATA-HPA068416-100,ATA-HPA068416-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CHOP, CHOP10, GADD153 |
| DNA-damage-inducible transcript 3 |
| Anti-DDIT3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1649 |
| UniProt: | P35638 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DDIT3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA068416-100ul |
|
|
HPA068416-100ul |
|
|
HPA068416-100ul |
Produktgarantie und fachkundiger Support
