Anti-DDIT3
Catalog Number:
ATA-HPA068416
- Images (7)
| Article Name: | Anti-DDIT3 |
| Biozol Catalog Number: | ATA-HPA068416 |
| Supplier Catalog Number: | HPA068416 |
| Alternative Catalog Number: | ATA-HPA068416-100,ATA-HPA068416-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CHOP, CHOP10, GADD153 |
| DNA-damage-inducible transcript 3 |
| Anti-DDIT3 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 1649 |
| UniProt: | P35638 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DDIT3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA068416-100ul |
|
|
HPA068416-100ul |
|
|
HPA068416-100ul |
Product Guarantee and Expert Support
