Anti-ABTB3, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA068658
| Artikelname: |
Anti-ABTB3, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA068658 |
| Hersteller Artikelnummer: |
HPA068658 |
| Alternativnummer: |
ATA-HPA068658-100,ATA-HPA068658-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
ABTB2B, BTBD11, FLJ33957 |
| Rabbit Polyclonal ABTB3 Antibody against Human ankyrin repeat and BTB domain containing 3. Validated for Western Blot |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 |
| NCBI: |
121551 |
| UniProt: |
A6QL63 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequenz: |
AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |