Anti-ABTB3
Catalog Number:
ATA-HPA068658
| Article Name: |
Anti-ABTB3 |
| Biozol Catalog Number: |
ATA-HPA068658 |
| Supplier Catalog Number: |
HPA068658 |
| Alternative Catalog Number: |
ATA-HPA068658-100,ATA-HPA068658-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
ABTB2B, BTBD11, FLJ33957 |
| Rabbit Polyclonal ABTB3 Antibody against Human ankyrin repeat and BTB domain containing 3. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
121551 |
| UniProt: |
A6QL63 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |
|
WB Image Caption 1 |