Anti-ABTB3

Catalog Number: ATA-HPA068658
Article Name: Anti-ABTB3
Biozol Catalog Number: ATA-HPA068658
Supplier Catalog Number: HPA068658
Alternative Catalog Number: ATA-HPA068658-100,ATA-HPA068658-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: ABTB2B, BTBD11, FLJ33957
Rabbit Polyclonal ABTB3 Antibody against Human ankyrin repeat and BTB domain containing 3. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.2
NCBI: 121551
UniProt: A6QL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP
WB Image Caption 1