Anti-ABTB3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ABTB3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA068658
• Supplier Catalog Number: HPA068658
• Alternative Catalog Number: ATA-HPA068658-100,ATA-HPA068658-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: ABTB2B, BTBD11, FLJ33957

Product Description

Rabbit Polyclonal ABTB3 Antibody against Human ankyrin repeat and BTB domain containing 3. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2
• NCBI: 121551
• UniProt: A6QL63
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP