Anti-WFDC8
Artikelnummer:
ATA-HPA071119
- Bilder (9)
| Artikelname: | Anti-WFDC8 |
| Artikelnummer: | ATA-HPA071119 |
| Hersteller Artikelnummer: | HPA071119 |
| Alternativnummer: | ATA-HPA071119-100,ATA-HPA071119-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C20orf170, dJ461P17.1, WAP8 |
| WAP four-disulfide core domain 8 |
| Anti-WFDC8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 90199 |
| UniProt: | Q8IUA0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WFDC8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human epididymis and colon tissues using Anti-WFDC8 antibody. Corresponding WFDC8 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, epididymis and liver using Anti-WFDC8 antibody HPA071119 (A) shows similar protein distribution across tissues to independent antibody HPA042710 (B). |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human epididymis shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-WFDC8 antibody HPA071119. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-WFDC8 antibody HPA071119. |
|
|
HPA071119-100ul |
|
|
HPA071119-100ul |
|
|
HPA071119-100ul |
Produktgarantie und fachkundiger Support
