Anti-WFDC8
Catalog Number:
ATA-HPA071119
- Images (9)
| Article Name: | Anti-WFDC8 |
| Biozol Catalog Number: | ATA-HPA071119 |
| Supplier Catalog Number: | HPA071119 |
| Alternative Catalog Number: | ATA-HPA071119-100,ATA-HPA071119-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C20orf170, dJ461P17.1, WAP8 |
| WAP four-disulfide core domain 8 |
| Anti-WFDC8 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 90199 |
| UniProt: | Q8IUA0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | WFDC8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human epididymis and colon tissues using Anti-WFDC8 antibody. Corresponding WFDC8 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, epididymis and liver using Anti-WFDC8 antibody HPA071119 (A) shows similar protein distribution across tissues to independent antibody HPA042710 (B). |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human epididymis shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-WFDC8 antibody HPA071119. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-WFDC8 antibody HPA071119. |
|
|
HPA071119-100ul |
|
|
HPA071119-100ul |
|
|
HPA071119-100ul |
Product Guarantee and Expert Support
