Anti-NDUFA7
Artikelnummer:
ATA-HPA071866
- Bilder (8)
| Artikelname: | Anti-NDUFA7 |
| Artikelnummer: | ATA-HPA071866 |
| Hersteller Artikelnummer: | HPA071866 |
| Alternativnummer: | ATA-HPA071866-100,ATA-HPA071866-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B14.5a |
| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa |
| Anti-NDUFA7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4701 |
| UniProt: | O95182 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NDUFA7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-NDUFA7 antibody. Corresponding NDUFA7 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA071866-100ul |
|
|
|
|
|
HPA071866-100ul |
|
|
HPA071866-100ul |
Produktgarantie und fachkundiger Support
