Anti-NDUFA7

Catalog Number: ATA-HPA071866
Article Name: Anti-NDUFA7
Biozol Catalog Number: ATA-HPA071866
Supplier Catalog Number: HPA071866
Alternative Catalog Number: ATA-HPA071866-100,ATA-HPA071866-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B14.5a
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
Anti-NDUFA7
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 4701
UniProt: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NDUFA7
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-NDUFA7 antibody. Corresponding NDUFA7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell line RT-4.
HPA071866-100ul
HPA071866-100ul
HPA071866-100ul