Anti-CASKIN2

Artikelnummer: ATA-HPA071906
Artikelname: Anti-CASKIN2
Artikelnummer: ATA-HPA071906
Hersteller Artikelnummer: HPA071906
Alternativnummer: ATA-HPA071906-100,ATA-HPA071906-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ANKS5B, FLJ21609, KIAA1139
CASK interacting protein 2
Anti-CASKIN2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 57513
UniProt: Q8WXE0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CASKIN2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & plasma membrane.
Immunohistochemistry analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
HPA071906-100ul
HPA071906-100ul
HPA071906-100ul