Anti-CASKIN2

Catalog Number: ATA-HPA071906
Article Name: Anti-CASKIN2
Biozol Catalog Number: ATA-HPA071906
Supplier Catalog Number: HPA071906
Alternative Catalog Number: ATA-HPA071906-100,ATA-HPA071906-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ANKS5B, FLJ21609, KIAA1139
CASK interacting protein 2
Anti-CASKIN2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 57513
UniProt: Q8WXE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CASKIN2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & plasma membrane.
Immunohistochemistry analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
HPA071906-100ul
HPA071906-100ul
HPA071906-100ul