Anti-TBX19
Artikelnummer:
ATA-HPA072686
- Bilder (7)
| Artikelname: | Anti-TBX19 |
| Artikelnummer: | ATA-HPA072686 |
| Hersteller Artikelnummer: | HPA072686 |
| Alternativnummer: | ATA-HPA072686-100,ATA-HPA072686-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dj747L4.1, TPIT |
| T-box 19 |
| Anti-TBX19 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9095 |
| UniProt: | O60806 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TBX19 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human pituitary gland shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no nuclear positivity in germinal center cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows no nuclear positivity in neurons as expected. |
|
|
HPA072686-100ul |
|
|
HPA072686-100ul |
|
|
HPA072686-100ul |
Produktgarantie und fachkundiger Support
