Anti-TBX19
Catalog Number:
ATA-HPA072686
- Images (7)
| Article Name: | Anti-TBX19 |
| Biozol Catalog Number: | ATA-HPA072686 |
| Supplier Catalog Number: | HPA072686 |
| Alternative Catalog Number: | ATA-HPA072686-100,ATA-HPA072686-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | dj747L4.1, TPIT |
| T-box 19 |
| Anti-TBX19 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9095 |
| UniProt: | O60806 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TBX19 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human pituitary gland shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no nuclear positivity in germinal center cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows no nuclear positivity in neurons as expected. |
|
|
HPA072686-100ul |
|
|
HPA072686-100ul |
|
|
HPA072686-100ul |
Product Guarantee and Expert Support
