Anti-SLC16A2
Artikelnummer:
ATA-HPA072719
- Bilder (10)
| Artikelname: | Anti-SLC16A2 |
| Artikelnummer: | ATA-HPA072719 |
| Hersteller Artikelnummer: | HPA072719 |
| Alternativnummer: | ATA-HPA072719-100,ATA-HPA072719-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AHDS, DXS128, MCT7, MCT8, MRX22, XPCT |
| solute carrier family 16, member 2 (thyroid hormone transporter) |
| Anti-SLC16A2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6567 |
| UniProt: | P36021 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC16A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ. |
|
|
HPA072719-100ul |
|
|
|
|
|
HPA072719-100ul |
|
|
HPA072719-100ul |
Produktgarantie und fachkundiger Support
