Anti-SLC16A2
Catalog Number:
ATA-HPA072719
- Images (10)
| Article Name: | Anti-SLC16A2 |
| Biozol Catalog Number: | ATA-HPA072719 |
| Supplier Catalog Number: | HPA072719 |
| Alternative Catalog Number: | ATA-HPA072719-100,ATA-HPA072719-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AHDS, DXS128, MCT7, MCT8, MRX22, XPCT |
| solute carrier family 16, member 2 (thyroid hormone transporter) |
| Anti-SLC16A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6567 |
| UniProt: | P36021 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC16A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Immunohistochemical staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ. |
|
|
HPA072719-100ul |
|
|
|
|
|
HPA072719-100ul |
|
|
HPA072719-100ul |
Product Guarantee and Expert Support
