Anti-SRI
Artikelnummer:
ATA-HPA073666
- Bilder (9)
| Artikelname: | Anti-SRI |
| Artikelnummer: | ATA-HPA073666 |
| Hersteller Artikelnummer: | HPA073666 |
| Alternativnummer: | ATA-HPA073666-100,ATA-HPA073666-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SRI |
| sorcin |
| Anti-SRI |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6717 |
| UniProt: | P30626 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SRI |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody HPA073666 (A) shows similar protein distribution across tissues to independent antibody HPA019004 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-SRI antibody HPA073666. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SRI antibody HPA073666. |
|
|
HPA073666-100ul |
|
|
HPA073666-100ul |
|
|
HPA073666-100ul |
Produktgarantie und fachkundiger Support
