Anti-SRI
Catalog Number:
ATA-HPA073666
- Images (9)
| Article Name: | Anti-SRI |
| Biozol Catalog Number: | ATA-HPA073666 |
| Supplier Catalog Number: | HPA073666 |
| Alternative Catalog Number: | ATA-HPA073666-100,ATA-HPA073666-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SRI |
| sorcin |
| Anti-SRI |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 6717 |
| UniProt: | P30626 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SRI |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody HPA073666 (A) shows similar protein distribution across tissues to independent antibody HPA019004 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-SRI antibody HPA073666. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SRI antibody HPA073666. |
|
|
HPA073666-100ul |
|
|
HPA073666-100ul |
|
|
HPA073666-100ul |
Product Guarantee and Expert Support
